3.12 Rating by CuteStat

thewatchmovies.net is 5 years 5 months old. It is a domain having net extension. It has a global traffic rank of #16029045 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, thewatchmovies.net is SAFE to browse.

PageSpeed Score
87
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 30
Daily Pageviews: 60

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 16,029,045
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

185.53.179.29

Hosted Country:

Germany DE

Location Latitude:

51.2993

Location Longitude:

9.491

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 185.53.179.29)

fscstore.com

- fscstore.com
Not Applicable $ 8.95

memberchannels.com

- memberchannels.com
Not Applicable $ 8.95

allwebsites.com

- allwebsites.com
Not Applicable $ 8.95

nationalconfidential.com

- nationalconfidential.com
Not Applicable $ 8.95

ankaaevents.com

- ankaaevents.com
6,312,630 $ 8.95

HTTP Header Analysis

HTTP/1.1 403 Forbidden
Server: nginx
Date: Thu, 01 Nov 2018 07:30:23 GMT
Content-Type: text/html
Content-Length: 162
Connection: keep-alive

Domain Information

Domain Registrar: ENOM, INC.
Registration Date: Oct 30, 2018, 12:00 AM 5 years 5 months 4 weeks ago
Last Modified: Oct 30, 2018, 12:00 AM 5 years 5 months 4 weeks ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns1.expiereddomainwarning.com 213.247.47.189 United States of America United States of America
ns2.expiereddomainwarning.com 213.247.47.189 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
888950.parkingcrew.net A 147 IP: 185.53.179.29
thewatchmovies.net CNAME 1795 Target: 888950.parkingcrew.net
thewatchmovies.net SOA 1800 MNAME: thewatchmovies.net
RNAME: dns.thewatchmovies.net
Serial: 1
Refresh: 10800
Retry: 3600
Expire: 86400
Minimum TTL: 3600

Similarly Ranked Websites

Jaw Crusher,Mineral Processing EPC

- papaboisconservation.org

BOSCH Armature IM105

16,029,080 $ 8.95

403 Forbidden

- onedefteam.xyz
16,029,090 $ 8.95

شمال موزیک

- shomalmusic.org

بزرگترین مرجع فول آلبوم موسیقی شمال ایران

16,029,121 $ 8.95

qlpxz.com - qlpxz Resources and Information.

- qlpxz.com

qlpxz.com is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find here, qlpxz.com has it all. We hope you find what you are searching for!

16,029,150 $ 8.95

Apple Support

- softwaresecurecloudestoragesystemsafewaningserveralert.xyz
16,029,182 $ 8.95

Full WHOIS Lookup

Domain Name: THEWATCHMOVIES.NET
Registry Domain ID: 2327611417_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: http://www.enom.com
Updated Date: 2018-10-30T13:39:46Z
Creation Date: 2018-10-30T13:39:46Z
Registry Expiry Date: 2019-10-30T13:39:46Z
Registrar: eNom, Inc.
Registrar IANA ID: 48
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.EXPIEREDDOMAINWARNING.COM
Name Server: NS2.EXPIEREDDOMAINWARNING.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-11-01T07:30:10Z